SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014043 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014043
Domain Number 1 Region: 380-483,584-671
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.54e-38
Family Bacterial dinuclear zinc exopeptidases 0.00034
Further Details:      
 
Domain Number 2 Region: 471-581
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.7e-28
Family Bacterial exopeptidase dimerisation domain 0.00019
Further Details:      
 
Domain Number 3 Region: 200-292
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000000000113
Family Bacterial dinuclear zinc exopeptidases 0.0012
Further Details:      
 
Weak hits

Sequence:  PYU1_T014043
Domain Number - Region: 15-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0111
Family Centromere-binding 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014043
Sequence length 702
Comment protein Name="PYU1_T014043" Note="Similar to ILL7: IAA-amino acid hydrolase ILR1-like 7 (Oryza sativa subsp. japonica)" AED:0.197415836889521 QI:0|-1|0|1|-1|1|1|0|702
Sequence
MSEDSAKKMKQGAGKRLNDKQRVEIIQISENSKISKRQLADKYGVSEAAIRKLLLKKDDF
LKRYYDTPEEIRDQRLRGKNLSMGDAADGTSAAGEAGEYTRAAGAGSHATGTAHAKSLYP
SDDPWKQGLHALAGKVTPFLKHFVQAKPVRDATAVAAAIAAAGDVLVGDQTLPTAAVEDP
IAAAAAQAAAVDWIGFSRMLRDIRRAFHRYPELGYQEVRTQSFIKRFCETTLRIPGKNIQ
TIAVTGLIVDVCFENATIPSSDKRKLPVLAFRADMDALPIEELNDHLPYVSTQKKQRKEL
RKRKKRKSMSGNAVATPVKPTDETQVALPDEAGLATLTSRSINGEDARDATADLEVETPS
SPTPVGADGDDFESDVPGVFPAAAHMCGHDGHMVMVLGLCALVVRNAHLLPQDTFVRFIF
QPAEEGPGGAKKMIEEGALEGVDEVYGLHNYPFPLYSVHMRPGPVMAHEVEFSIDIHGVG
GHGSAPQQCVDPILAGSMVVQALQSIVSRSLSPTDTAVVSVTQFRGGDTNNVIPSHVFLG
GTIRDFDLEVAEKIKARMEAIVHSTCAAHGATAQVHFSDGYAPVINPYEETRNVQQVAMD
IGLYVSEQGLPLMAAEDFSYYLQERKGCFFFLGTKEDADDDKTRALHSNQYDFNDKAIPL
GIRLFLGILQSRFQCELYSVEELQAFQVAMERIALPSSVTIV
Download sequence
Identical sequences K3X9Z4
PYU1_T014043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]