SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014113 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014113
Domain Number 1 Region: 19-280
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.66e-55
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 321-522,575-670
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-39
Family Extended AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014113
Sequence length 821
Comment protein Name="PYU1_T014113" Note="Similar to ROA2: DNA replication licensing factor MCM3 homolog 2 (Zea mays)" AED:0.0846380295367992 QI:0|0.66|0.42|0.71|1|1|7|0|821
Sequence
MELQQDALDEAFRRHKNYFQHFLENEDGFGNYSEKLRTMMNQKASRLTVDLNDLREYDSS
FTDAATSGQDNIADRILRNPMEYVPPFEAAVKDLVFNYDSMYGSKEQESSKDMLFHVGFE
GDFGHHNVNPRGLLASYLCQMVCVQGIITKCSAVRPKVVKSVHFCKETNALLSREYRDNT
SLTGLPTSSVYPTKDENGNFLETEFGLSQYKDYQMLSMQETPETAPLGQLPRSCDVIVEN
DLVDKCKPGDRVRVIGIYRPLGGKSAAQSTAVFRTVMIANNVQLLGKEVNGIVMTTEDLL
NVREFAKREDAFEILSRSIAPSIYGHAEIKKALLLQLLGGVEKNLENGTHLRGDVNILMV
GDPSTAKSQLLRFVRTIAPLAVNTTGRGSSGVGLTAAVTLDPETKERRLEAGAMVLADRG
IVCIDEFDKMGEADRVAIHEVMEQQTVTIAKAGIHATLNARCSVLAAANPVYGQYNKNKK
PQENIGLPDSLLSRFDLLFVVLDKLDRGADRNISDHVLRMHRYTRAGQEGTPLSFEVSST
DHMALLKDTSGDSSDATESIFQKYDPLLHGGYQSSSYSGSGNGILTLDFLKKYIYYAKTR
FQPVLTDTAIDLIAEGYAELRSQQNARTLPVTARSLETLIRLASAHAKARLSKSIEREDA
EKAMGLMSFALYHDTSEPTASDDKGHAQDVHMADEQELSIQKAVGNPVDETDLDEPVSPV
KADKPESRKRDRAAAWSVDELADEVSLALTEMADKKNKESNDLDNDDDQFPLTDVLEHVN
RKRARSDLVARGELEKVLIALEEQNKLMYIRDGDDPVVMLI
Download sequence
Identical sequences K3XA64
PYU1_T014113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]