SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014193 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014193
Domain Number 1 Region: 1603-1656
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000202
Family Myb/SANT domain 0.02
Further Details:      
 
Domain Number 2 Region: 1132-1195
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000979
Family Myb/SANT domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014193
Sequence length 1738
Comment protein Name="PYU1_T014193" Note="Similar to Ncor1: Nuclear receptor corepressor 1 (Mus musculus)" AED:0.420977094115392 QI:0|0|0|0.4|1|1|5|0|1738
Sequence
MSNFYDRNSSSDFYDGRGRSRDRDSSVGRGSNWPASRAGGSGGNGGRYSSFGRGGGGGGE
RNRFFQKDPRFPSNYIKASGNDSRYGSRRSESRDRGSADGSHPSGGAAGGSFRDRNFRER
ERDRDSGAPIRNPNAGPDNARRSGSVLSRLNDPTGSAEDRRGEAGDRATDRKKEDRDSDK
ERRGGSERDFLPPGGLDTKAKRDLLLSARTLPPRPSFHFNSTSSAGGSRASTPKESQDAR
DDSSANEKPTTKDSFFMSDEDMDLKAQNEMESVQDDEKQSNQADAGVEIDVKQAKNESGG
EPSATEHIEDEDTTLEEKQSTNADEENSMSIEFDGKIAVTCHNTLDSTKPDADVEMISSS
VPDDAKSNDKNDLSEERRATNAQSGDVILADKERSRAEVTEDMIDADMRDSSSAEVEVKT
ETNRSEPADVSMEDVQTSYPVVVESRVEDTDAVTSETEPLSGTTAEEVAHLTSLQNERDQ
IALSGDATPSVTVVVEEIASNASKEQIESTSSQHESEPSSTAVSLEPCENQTSSASVMDE
VERDVISETPDKTQDVEVADNEGTGDKSTISVVDEAPAMDVDAIKPAELKLDEKVDSQHG
EVVSITGERQVEKPEKIGVVENVDDSVEMEEGETQSAADGVRDKREDAVSSSDRHDDPKL
FASEVVAEEEKKHFADVTDSRAGMPIVRDLAEENKTVFNSPPQSSVAAAGHSVVESVTEL
TSVKSDEVVQSVESETKNPTQDGQTVSQIDLPLQSQDSAAKDSEDVIMKSEEATEGGKLE
NDSPSKPSKEEILSSIDGLDSDISSVKKHIRLLQKVVMEAEAASTSLPSDHHADGSHELA
QVELKSESQNGSATSKEETPIEEIPESVSRGVLPVKIAVDSAFVELAASVFSENARKATV
ANDQVPKRTVNSEVVTTIYRQPSDYPIYHENLARGLELRDSIRLKVRTRNRLRHEHLKKL
AREYVDLKKMWKQRVKKMEKDRKRQDKLRTKQKLKQKQKSASSSGDAGGGMSNQQSSSVP
QIFASGTGSGGIGGSDIGYSGGNNSGAVGNSVIRTSSRLTNNSSAELQSKSDLEKLEQAK
AQAIADQEVRKKRLKNALTTIVPDMIISHEEREARYFVRFGNGQSCMTNGVAYDWRKREK
AEMLVNPWNDLEKCIYIDKFLQYPKNFARISSFLSNKNTGDVIAFYYRTKKIVDYKALLR
EQQLRRRGAGVKFPDRVARLLLHPSNFRSHQASENIINSAGAQLLLRNTVKKDDERISTS
GLNGVSALAAISAADSGNLKNSPRATEAADTRKSSLDDDATDAQQLDLYSQKLSQFVTGQ
QRPFLVNFAEFLSDNSYSTGFEVSTLSVAERLKRYRLPVESKNADKTTAVVDKSTGNSTR
SNVVENAPDASLKAKNQLVSNTGSNSSSKNGNGGTSSQLTKKEQKQQRKMKKIQDAVSQP
PAPAAVLLASSDTFSTTASGSGTAASNQVATSGRKKSLPTPPVVTVGTANRNSPRVSTGE
EKTVAPQKKSGKSGNSAANSRRNSHVQSTNTPSPKPQAATAAPELTPLTVNIESGVFVLQ
PEPTPTMMPTIINPTPELSPPVAALLTPASSTSASGLVSAPAAKRVVQKWTEAEKADFLK
FFSMHGKDWATLTDSIPTKTAAQIKNYYQNYKNRLGLQDILKRRIEKSSAGTSGGAPSST
SASGSVGSTSSVTSPPHDMQVTSSSSVPSSIPAVSTSAMAVLDSSASLQAVVNKRHVN
Download sequence
Identical sequences K3XAE4
PYU1_T014193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]