SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014216 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014216
Domain Number 1 Region: 6-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-25
Family BM-002-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014216
Sequence length 65
Comment protein Name="PYU1_T014216" Note="Similar to CBG12253: Probable ubiquitin-fold modifier 1 (Caenorhabditis briggsae)" AED:0.575379967903332 QI:0|0|0|0.25|1|1|4|0|65
Sequence
MGKALAPFTAVLKYVAEEFHVPAATSAIITNDGIGINPSQSAGNVFLKHGSELRLIPRDR
VGGRL
Download sequence
Identical sequences K3XAG7
PYU1_T014216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]