SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014247 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014247
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 7.85e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00019
Further Details:      
 
Domain Number 2 Region: 81-173
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.2e-17
Family Cold shock DNA-binding domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014247
Sequence length 178
Comment protein Name="PYU1_T014247" Note="Similar to DNA-directed RNA polymerase II subunit RPB7 (Glycine max)" AED:0.268156424581006 QI:0|1|0|1|1|1|2|0|178
Sequence
MFFLKQLSRDLLLHPMHFGPKLHDIIRLRLIEEVEGTSMGKYGYVITVTEVRDEDIGKGV
IQDNSGFVCFNIRYRAILFRPFKNQVLDAVVTVVNQLGFFADVGPLQVFVSRHAMPTDLN
NGYDHENNAWISDDREVEIRKGCGVRLKIMGVSVDVTEINAIGTIKDDYLGLISSENF
Download sequence
Identical sequences K3XAJ8
PYU1_T014247 EPrPW00000014525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]