SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014250 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014250
Domain Number 1 Region: 2-247
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.09e-86
Family Tubulin, GTPase domain 0.00000126
Further Details:      
 
Domain Number 2 Region: 248-441
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.23e-64
Family Tubulin, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014250
Sequence length 458
Comment protein Name="PYU1_T014250" Note="Similar to TUBG1: Tubulin gamma chain (Physcomitrella patens)" AED:0.00435729847494559 QI:0|1|0.5|1|1|1|2|0|458
Sequence
MPREIITLQVGQCGNQVGAEFWKQLCAEHGISADGIVHDYATQGHDRKDVFFYQADDEHY
IPRALLMDLEPRVINSILNSGYRNLYNPENFFTSKDGGGAGNNWASGYHQGEQHHDLLME
MIDREADGSDSLEGFVLCHSIAGGTGSGMGSYLLENLNDHFPKKLIQTYSVFPNQADFQS
DVVVQPYNSILTLKRLVLNADCVVVLDNTALNRIAVDRLRVENPTVSQLNSLVSTVMAAS
TTTLRYPGYMNNDLIGLVASLIPTPRCHFLMTGYTPLTIDAQVSAVRKTTVLDVMRRLLQ
PKNIMVSTSTKKGCYVSILNIIQGDVDPSQVHKSLQRIRERKLARFIPWGPASIQVALSR
KSPYVETAHKVSGLMLANHTSIGSLFQRSLVQYDRLMKHKAFIDNYKKQPMFADSLEEFD
SAREVVQSMVDEYKASERADYATWGQQQQVSADGDVRM
Download sequence
Identical sequences K3XAK1
PYU1_T014250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]