SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014281 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014281
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.49e-17
Family FHA domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014281
Sequence length 878
Comment protein Name="PYU1_T014281" Note="Similar to SETD1B: Histone-lysine N-methyltransferase SETD1B (Gallus gallus)" AED:0.217102768297308 QI:0|-1|0|1|-1|1|1|0|878
Sequence
MPHEPTSHDATSALRDGLACCFRWEITRGPHEDMLLTHCVHEDAPATLPRVLKVGRHKQC
WMRLRKDLEVSSVHAEFRVQADGTTANADATAAAANADNEAIQRVVLSDLNSTNGTKLNG
EPLVPHQEYPLADQDLIHFGKTAVRFRNSNNRNVKEPKQDGSSSRVVVIVDESDEQQMRA
TDLVEQTVVTVVSARSSVVDSDAAAPQTTQMQEYEPSKSTSKSVQKIRHDTGGGFATEED
DVFELPSATHQVMQHLSVSSSSASGASAMTCMICGQWLGHLDVLEQQLHINACLDGRQRP
PRPEDAWSSLLQPAAQNKRAAPKNQGRKRKRARDQSSSIEDEEIAIAVAMSKSIANKEQE
VDMNIALLSGELTQIDAQMAKLAKKRDALVKKMAKLEKTKDRVKKSTVLPPSEARILLDL
AKVLQILFPQDRVVLAVHADDAWRRILVLQQKKNRAVADHYAPGMKRCLFSDNSEPLPPM
WVRASQQLFGHMERDLYQNSILLPFVGREDPDPVAEMEEVKDATTDSNLFEETQTAVQQQ
CQSAVPGVVKRVFPDWAENLAFLQQQCLEDLEEALHEMSCQRQDRLNEEPESEDEVPMLG
SGSSSKAEEDQARAYFESVIKELIQTKLPAGTRQVIDVEDSDGMDDEQGVNDVKRSSIIS
IDDNSEEEIEDITESTMLSQQQVDMCFSPSHEVPTDEDFPAGRDSEIGADRYLSDVVVIE
TLGVCSTLAERIENALQEDTTSDSAAAESQAALLAVFTQPTAREGTLLEEAPSALDALKY
HSTVLPRIESVAVELDSASDLDGRQQQKCTAGSDESMETQLLRVLKAHPTFYEMVLLHRP
LDFATFFQYVTQEANVPCTKKFVHEFLDRHGITFRQPT
Download sequence
Identical sequences K3XAN2
PYU1_T014281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]