SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014297 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014297
Domain Number 1 Region: 10-161
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.09e-24
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014297
Sequence length 177
Comment protein Name="PYU1_T014297" Note="Similar to Cml2: Probable N-acetyltransferase CML2 (Mus musculus)" AED:0.0421348314606742 QI:0|-1|0|1|-1|1|1|0|177
Sequence
MARRRAPAPPLALEIRQFRAQADQVAVLALFEEGMLAYADHGASAASLAYIQRSMETDLA
DIPGVYIKAGGNFWVAIDEAVNEVVGMIALGKTRAGAGELRRMSVRHEYRRLGVGTCLVH
HLEEWAKTNKFTSVSLTTGEVMLAAQQFYTNIGYKKQGTIVRCEDPYYADVLFEKQL
Download sequence
Identical sequences K3XAP8
PYU1_T014297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]