SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014331 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014331
Domain Number 1 Region: 8-63
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000887
Family Paired domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014331
Sequence length 352
Comment protein Name="PYU1_T014331" Note="Similar to Snap91: Clathrin coat assembly protein AP180 (Mus musculus)" AED:0.205382436260623 QI:0|-1|0|1|-1|1|1|0|352
Sequence
MERRGVGKRLTDGQRVEIIKLFDSGAAVTEADIARRYGVTRSAIWRLRRASSQIMERYQE
GDIESRDERRRGSITSSNRQFIDSVMATASTAPPPAAASASVPTTTALVTTATAASESGE
SEPATINVDSLTAMTTGASAEMLTPSHNNNNSAMMLGMIQASNSGVDASPSILVGVNAHG
SGAGGARPKPRTGGATGAVVVDAGRANSDVELVPGTVMVPDPVLPLIYLAAKAIGSVQSP
GVINWERQNGYDDANHFLIVNDGISVVQEGNYQLNIDIEHSQPRQNYKFTFKVWNGKKLL
GQCTCPIRTKKEISLSLLELRCKLQAQARLRVEFLAPGFAFHESRFVIRLVQ
Download sequence
Identical sequences K3XAT2
PYU1_T014331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]