SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014332 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T014332
Domain Number - Region: 106-146
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000699
Family Centromere-binding 0.014
Further Details:      
 
Domain Number - Region: 6-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00125
Family Centromere-binding 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014332
Sequence length 413
Comment protein Name="PYU1_T014332" Note="Similar to 71: Glycoprotein X (Equine herpesvirus 1 (strain Ab4p))" AED:0.00241545893719808 QI:0|-1|0|1|-1|1|1|0|413
Sequence
MSYARNFLTNEQKLQLREYWAENPELSHFEVADWVAAQFQIQISRSTLYRISQAPVTAFA
GNLHQKKGRRVKYPEFESELVAFYHACRRRSGSGSGEDSGEGAQQELTVELLLRKAVELR
TKHGIPQDKLKLSNGWMHKFKDRHFLKTHQQNGAAERHAPEQVGGEGETENKRQRASARE
QERDVATPQVAAAVATMAPASTTTPTRATRSPPMTATSDERATIDTQTTEPTIVPPAPVA
VTAVTSIISATSAVTATAATTAPAHASAVPVQVSSSTLQIRPLTHIAAKSLNTVHSQGTF
NWERTSGAADAYFAIVNDGIQIFQDGMYQVNVDLEHTKHQGGTSGSDPIFNVWNDAHLIG
RCTCSVHCDPVTGAMLSVVEIQTFLKADSVVRVEFLAPGFALHQSRIVIRLLS
Download sequence
Identical sequences K3XAT3
PYU1_T014332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]