SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014353 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014353
Domain Number 1 Region: 49-330
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.09e-50
Family Sir2 family of transcriptional regulators 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014353
Sequence length 368
Comment protein Name="PYU1_T014353" Note="Similar to SIRT6: Mono-ADP-ribosyltransferase sirtuin-6 (Homo sapiens)" AED:0.0433604336043361 QI:0|-1|0|1|-1|1|1|0|368
Sequence
MKDLLNAADDTEVHVDVVDNPQAHAEQVHVRVASDDKSENCRAATPSASEQTNAHDELDA
KCRRLAELIAKSKHLVAFTGAGISTSVGLPDYRGDNGIRTKGFVEKHKRRKLDSATSSSS
SMRRGSTSSSDSESGKQVVIPDFNSLVPSKTHMALYELHRLGYLKHLVSQNVDNLHLKSG
LPASALTEVHGNATQAKCETCEKIYTKDFPWTGLCDDPACVSTKRSVEQRLRARTRHGNG
RLKRNVISFDEPLDDIDHAIDECEAADVALVLGTSLRVEPFSEMAGEFADALVIVNLQPT
TQKLDKRAETSGVRFFEKCDVVMEKTMKFLLGEQYEIPAWSGTHPTSVFIPEHEDKNLVN
VLAGRLLA
Download sequence
Identical sequences K3XAV4
PYU1_T014353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]