SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014536 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014536
Domain Number 1 Region: 393-619
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000354
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 
Domain Number 2 Region: 1047-1111
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000209
Family Myb/SANT domain 0.024
Further Details:      
 
Domain Number 3 Region: 99-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000162
Family Tandem AAA-ATPase domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014536
Sequence length 1392
Comment protein Name="PYU1_T014536" Note="Similar to EP400: E1A-binding protein p400 (Homo sapiens)" AED:0.239091769093706 QI:0|0|0|1|0|0|3|0|1392
Sequence
MDIEAIDERMEKLASGSGEVESTVELNYKKIEVLSDSPEERCVNAARSKMKRIVATGQKA
RDAMLSNVKNEDSASSTERALQEIQTRSSSHGDGGRSPSTVLAAFQILALRWMLELYGAG
LNMLLNDQLGMGKAATISAFLNLVNRLEGHVESSPDASRKDGTVTGPHLIIVAGEELHKW
QFALRAWCGQWKIQVYQGTSRYRKQLQREWKTQSVTAGAVGDQFFNDFDGDELWNEDTQP
VFCVLCPVRAFLEDSGDFIGFNGWQMLVVENEFDELFEDSKVVADLKSIPQKQRRILCNG
RSIDNWNNVSVRNHYAEFLLKDCSAAEGEEWSADVWSRLLQLDKLSVAHAMQACGKSSSA
VASLWKSAQPESQNYVGVIVVALYCLGLRRVRSEVETQLGKIEEQSLSCKLGASQLAQYR
TAISGFVSSISVTSEREERLEVWLQLFLRLRTICNCVDIVNDFDKLALADMRVMLSCSAK
LDALSSLIHRLVVKEEKRVVIYCQFNGMFPILEMFLTLLDVSFVRIAGKAEMQRRALSHF
AERMAVKVALASTRLSCQQGTRAVTVYGADAIIVLDSDWSAICDAKLRASWAKMAVGRDV
VPVYRLHCEQTIEASLLQVGACFSEKVFSEMTPQELLSVPTDLPVGSALEKPSWWTSNPS
SGTAAASIIANIATSARRAEDEENFCGDESELERPLLVYNIDLDAEEHLLLSNTDELTPV
EWYAVNYVHGLTDKKRGNQSDDDAGNHDDESTNDGWMSTYGQTITRSFDEFATIENKQQW
QNGNTQSQLFYDSSVSFGPVDEKTVEKLFDHLRVKGVEAHYDVYKPPQPPTDEQSEVFCE
PGTDAGNQMLFHVSYRVPAPPAPPPAIKAKSEQASLAQSDTTSKPIKVKKQRNSAGNAAA
TTGAVRTGTIPPTAAVTGVKRKLDQQSAGTAVVRTPSTKEQRVDLEGIPLPDVAEFEDDD
FWGDTNLDALDSASWDDASVLTGILGSTAESSSGVNSSSTAGTASTTQESATSGTKPITK
KAKGSTGTGTGTATNRARKGSVSSDSGRDGWSSQDDMVLKKLFELYGSNWTLIAQVFNST
TAVSRFFCKKRSPRQCYDRYGKIISGSLSSGSSTSTSSGSSGVKDGKSTKNSKFGGGGIH
MLISPEMLDARIGLPVDEMLLVFPARNSLPGLPPPSIINVPNLVEMSMKKKKMQKQLPAN
SLGAGDAGGMDDLKSIRNSFDAIIQCMKRKTAPPPIPIPSASPPAASDFSMKASLTATGA
ASFSPSPASKAAKSGNASQALTSKTTTTVSPPHKSHMDIISLLPNGAFKQQLQLCPLVAM
HRLFPLLVTQLLGQRSARPQLPREKRTLPIWEELEVQETTEDQEAELCWLMVFLNWVSSL
CWHKCYIFTCLG
Download sequence
Identical sequences K3XBD7
PYU1_T014536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]