SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014544 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014544
Domain Number 1 Region: 95-153
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000147
Family DNA-binding domain of telomeric protein 0.019
Further Details:      
 
Domain Number 2 Region: 23-84
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000758
Family DNA-binding domain of telomeric protein 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014544
Sequence length 237
Comment protein Name="PYU1_T014544" Note="Similar to mug152: Meiotically up-regulated gene 152 protein (Schizosaccharomyces pombe)" AED:0.075 QI:2|0|0|1|0|0|2|1|237
Sequence
GYAFPRNSPEFACENVGDRVKGKRRKYCPHEVTALVLGVQRYADDSCPWSSILRDPHLGH
LFHGRSGVDLKDKWRTLIKTRPELASYTENRKNHRKYRPFSAAEERALMEGVKKYNGQRN
VWSLILIDKDLGPQFNDRSNVQLKDKFRTMRRSGTTSSVVVSNPSSRRSSNTPTSASGGT
PSGGRQSTSSSGRPLTPTSAALSAAVSAAINGGSRSGSVSAVSQQAANLLCCIGNLC
Download sequence
Identical sequences K3XBE5
PYU1_T014544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]