SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014609 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014609
Domain Number 1 Region: 120-222
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-25
Family Canonical RBD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014609
Sequence length 418
Comment protein Name="PYU1_T014609" Note="Similar to sce3: Probable RNA-binding protein sce3 (Schizosaccharomyces pombe)" AED:0.10412230431738 QI:0|0.4|0.16|0.5|1|1|6|0|418
Sequence
MAKNLAFKPFGADNGSSWADEDDDVEPLVIAPPKVPTVAETNQPEHEEPERRDYDRTVDR
HHGGARGDHDRHYDDRRGGHHDDRRGGHDRHYDDHRGGHRERDNYRSHRDAERPREHVER
VKNPVPDHPPYKIFVGNLPFRMHEDELADFLGHEGIRDIRFPKDFDTNRPKGFAYVEFDD
REALVRALELDGHDVDGRAVKIDVAAEKNPRQDKSGGFFTKRRNNDAVHEEATAPKERPR
LTLLPRNTPTTEKSDGSKKASIFGDAKPRDENAYLERRKSKELERKKSVDDVKTPKAEGE
KKQGPPSRKNSHDDGFGLARGGRSGRSERGGRSERGRGERSGGRGEHHAGGRGGRGPAPA
PATTTPKKEKPAEAAAPAARKSEPRQKRTEPVKTKIAAPAPAKITNTFSALDLDSDSD
Download sequence
Identical sequences K3XBL0
PYU1_T014609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]