SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014620 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014620
Domain Number 1 Region: 32-274
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.09e-100
Family Tubulin, GTPase domain 0.000000000509
Further Details:      
 
Domain Number 2 Region: 275-460
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.78e-81
Family Tubulin, C-terminal domain 0.0000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014620
Sequence length 477
Comment protein Name="PYU1_T014620" Note="Similar to Tubulin beta chain (Phytophthora cinnamomi)" AED:0.00336597307221542 QI:1|1|0.5|1|0|0|2|199|477
Sequence
PNSSQSPRQPATEPPPQEKHPSSFAAKQTDIMRELVHIQGGQCGNQIGAKFWEVISDEHG
VDPTGSYHGDSDLQLERINVYYNEATGGRYVPRAILMDLEPGTMDSVRAGPFGQLFRPDN
FVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAESCDCLQGFQITHSLGGGTGSGMGT
LLISKIREEYPDRIMCTYSVCPSPKVSDTVVEPYNATLSVHQLVENADEVMCLDNEALYD
ICFRTLKLTTPTYGDLNHLVCAAMSGITTCLRFPGQLNSDLRKLAVNLIPFPRLHFFMIG
FAPLTSRGSQQYRALTVPELTQQQFDAKNMMCAADPRHGRYLTAACMFRGRMSTKEVDEQ
MLNVQNKNSSYFVEWIPNNIKASVCDIPPKGLKMSTTFVGNSTAIQEMFKRVSEQFTAMF
RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFDEDEEMDEMM
Download sequence
Identical sequences K3XBM1
PYU1_T014620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]