SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014632 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014632
Domain Number 1 Region: 54-191
Classification Level Classification E-value
Superfamily Cyclin-like 8.85e-45
Family Cyclin 0.0000514
Further Details:      
 
Domain Number 2 Region: 195-319
Classification Level Classification E-value
Superfamily Cyclin-like 9.85e-30
Family Cyclin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014632
Sequence length 338
Comment protein Name="PYU1_T014632" Note="Similar to CYCA1-1: Cyclin-A1-1 (Oryza sativa subsp. japonica)" AED:0.0872422952970573 QI:0|0.75|0.6|0.8|1|0.8|5|59|338
Sequence
MDSDGMNVDEPVVRKPVALPSLTSYTPRPYLFKYDHNDSGFDERTYASLVRDIDAPTPCA
KLARELDIYYRKHEAKYLPEASYIGTYQTDINEKMRTILVDWLVEVGEEYDLDSQTFHKA
VNLVDRCLTKFKINRKQFQLLGCACMMIAAKFEEVYGPNVEEFVYISDQTYTAEEMLEME
GKVLQALEYRIASTTCYGFITRYMNAGCNTDKQRSLVMYLCDFALLYYHMLRYRPSEIAA
SAVYLARFMSKEKHPWTPTLHHYSKYNPWDLKNCILDLCRIHKVENEVVGTQRDKAKAVS
EKFLAEKFHGVSAIPSPDEVELDKSFFLYDPRQSSSRS
Download sequence
Identical sequences K3XBN3
PYU1_T014632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]