SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014655 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014655
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Cyclin-like 1.12e-29
Family Cyclin 0.0013
Further Details:      
 
Domain Number 2 Region: 147-254
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000000386
Family Cyclin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014655
Sequence length 399
Comment protein Name="PYU1_T014655" Note="Similar to CYCT1-1: Cyclin-T1-4 (Oryza sativa subsp. japonica)" AED:0.000295857988165671 QI:407|1|1|1|0.5|0.33|3|82|399
Sequence
MANDWIFTEKELRSTPSQRDGMKYVDELILRRKACDFIEKMSKSLDLPKLAQISADNFLH
RFFMRQSLVRYDKYLVAAACVLLGSKAEESPKKIGYVAKEYIAVRKVVEKDQVFAIQKHD
PQVIAGKIISMEGVVLHALAYELTLSHPYKYINEKVDKVVRLQELSEEDVKSLSGKIKQV
AWSFLNDSAYTLACLRLDSNDLAAGAVYLAGLYESYIPEGVCTRDGEPWWNVLSTPVNTL
QDAARYLLEAYTEPYIRTQVLPAGLSKLVYIYHPPKRVESPVAMFADMEFEEQEHSSSMS
SPMDSALCVTSPECGGSQGRSPFDHDFDHDVKSHKDGEESPRETAQVPSIPASLMDSFSS
GNNSSSADKLFGTTKQSRKRVKESSERKYCVGKKSKYSL
Download sequence
Identical sequences K3XBQ6
PYU1_T014655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]