SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014663 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014663
Domain Number 1 Region: 7-344
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.33e-105
Family DAK1 0.000000595
Further Details:      
 
Domain Number 2 Region: 377-587
Classification Level Classification E-value
Superfamily DhaL-like 1.26e-46
Family DhaL-like 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014663
Sequence length 591
Comment protein Name="PYU1_T014663" Note="Similar to DHBK: Putative 3,4-dihydroxy-2-butanone kinase (Solanum lycopersicum)" AED:0.000844594594594517 QI:0|-1|0|1|-1|1|1|0|591
Sequence
MSSKPRQLVKDASTIVRDMLDGLVAAQPHLVLVRGENVLLHREFRNIRAQQVTLLSGGGS
GHEPAHAGYIGDGMLTGVVCGGVFASPSTKQVLAAIRLAAGPKGCLVIVKNYTGDRINFG
LAVEQAKAEGFKVDMVVVGEDVAVVNANAGRRGLSGTVFVHKLAGAAAKAGKDLGEIVKL
VNGITAANKIGTMGVAIKPCSLPGQEDHSRDLGDNEMEVGLGIHGEPGIEKRELLDVPAL
TDLLLEKIISDTSAVGLKLTSGSKCVLMVNNLGSTTTMELFVVTKYAVQALQSKGIAVER
VVVGSFMTALDMGGFSLTLWNSNGDAELLGFFDAPTTASGWSHTKYTPSALNVDSGSEIE
PHVPVDVAAKKASARPAQLTSNGLLLEKAIQAACNELIKREPELTLWDSKVGDGDCGTTF
KGAAEQILADLHAHYPLNDAAHTLREIAQSVGKSAGGTSGVLYDIFFTAGALKLESFKDQ
GAAAWVASFRAGIAAIQKYGGASEGSRTMLDALLPAERALGDPSSSDTVALLSAAAQAAK
EGAEATKKIPTKQAFGRSGYVGEEFSADIPDPGAKAVAFWIAAVADAAKSQ
Download sequence
Identical sequences K3XBR4
PYU1_T014663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]