SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014733 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014733
Domain Number 1 Region: 376-440
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 166-363
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000238
Family STAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014733
Sequence length 480
Comment protein Name="PYU1_T014733" Note="Similar to ZFYVE21: Zinc finger FYVE domain-containing protein 21 (Homo sapiens)" AED:0.00412371134020617 QI:0|-1|0|1|-1|1|1|0|480
Sequence
MRAHANEPRGRTRASSYSSYSNTPFAPSSGVISTSYHDRRIDALTASFTPTYDREMRFDE
RDDENDESGAEYKDDDDDDGNAPATDDDDADRCYYHPARAHKTSTKRTRRNSVGDKNTSA
TELSRAQKQGCFNYIKRRHSIALAFASNASLRDENSPFAEPTDVVTNWEYAKTKHGVTLY
KSKRSRCEVRAVTRVNSSVKNVMVLLAAGETTENFAHAQNALLGEENVLEARVLASCVPS
TASRFFHCGLKYLAMKNPFGVTPLDLVFLDYTDVSTTPDGKLVGYRIMESIRVPEYQAAV
PKYVRASLRCEVYVVRETEVSGVVEVTFASHLDPKSKYSSSKRTHWLEQAGQRLRNLRSY
AEKASLSHKLILEKGKWIKRDARHHCFVCDASFSFLRTRHNCRLCGEVTCGRCSRKLPIL
VANETTRVRVCLRCILDSRHQPDELGRSQVAGGFGRRGSVGNSTYIAYDEIDPKQHDDHE
Download sequence
Identical sequences K3XBY4
PYU1_T014733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]