SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014826 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014826
Domain Number 1 Region: 259-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.3e-54
Family P-domain of calnexin/calreticulin 0.000000937
Further Details:      
 
Domain Number 2 Region: 62-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-44
Family Calnexin/calreticulin 0.0000131
Further Details:      
 
Weak hits

Sequence:  PYU1_T014826
Domain Number - Region: 403-446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0117
Family Calnexin/calreticulin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014826
Sequence length 573
Comment protein Name="PYU1_T014826" Note="Similar to AFUA_4G12850: Calnexin homolog (Aspergillus fumigatus)" AED:0.0705574912891986 QI:0|-1|0|1|-1|1|1|0|573
Sequence
MKISSSILLALTASALLLQNGATAKDGAANKATEDTLATSAQETKHQEDLLQKVKELAAH
GVLVETFEEEELFDGKRWFKSSHEKYTNQEVSVDEYTVRTGHVSPDKGLVLDAPAKHYGL
AVKLDKPLHIDGSEQNKELVVQYEVKLQKGLNCGGAYVKLLRANESTDFKTFSDDTPFVI
MFGPDKCGSSDKVHFIFQHKSPVTGKYEEKHMMSPPQIKSDRLSHIYTAVMRDDNTYEIF
IDQKSVSKGSLLENFVPSVIPDKEIDDPNDTKPGDWADESKIRDPNAVKPDDWDEDAPAR
IPDTDAVKPADWLDDEPALIDDPSVVKPEDWDDEDDGEWVTPQIPNPKCENAVGCGEWQR
PTKANPAFKGKWYAPLIPNPAYKGEWEPRKIPNPDYFEDAHPARLDPIGALAVEVWTMSD
GITFDNFWLGNDLKKAQEFAEVTWVPKHNLEIEEQEKAREKEKQERQAKESGFLNSIETM
FMDFLAFAQANPVVGIGSALAVGFVTILAAFFLCCGKSDEIAVEQKEKDSGSEEDVVSED
DKKASDKKQAAESSADEGTQKVRQRKKKAPIAN
Download sequence
Identical sequences K3XC77
PYU1_T014826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]