SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014846 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014846
Domain Number 1 Region: 94-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000597
Family Canonical RBD 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014846
Sequence length 462
Comment protein Name="PYU1_T014846" Note="Similar to Aff4: AF4/FMR2 family member 4 (Mus musculus)" AED:0.0145857854168412 QI:0|1|0.85|1|1|1|7|295|462
Sequence
MAPPPGAASRRSASKGGRGGRGRGGGRGDKVPAAAAEDAAPRPSARDAKAKPHDSNKQHK
RGKGGAGANVANGRAPSSNVSSARPTRAVNAVMRKVVVRNIPHTTDEDAIWALVEAHGVT
RESLWRFVPGKVRGNNRQPTTGRMYLDLKKDLEQARRLIAALNGHVLDVTADPPARLEVE
FAPYQKIPRDKQRKDAKVGTIDRDPEYLAFLEELAKPKEKLPSAEVVADTAEVDVAEKPV
AALVKYMNERKVHSRDKGKGKSGKFAEKGSAAGKRQTRKKEKTTKEKAKTPKDRRKNADG
ATDAAKPRKTRGGAKSSSKKDAAASQEPIQPGAIRIMAPKSPAAAAAGNAATQQPSNGTD
AKNKSNKKAAAASGGGAGGGGEGSSRSRGKGRGSERVPKEVKPADASGGVDNNGNGEAKN
PRRRDSRASAPGAGGNAVGKKDNNAGRGDRKKKVFVPKDQSG
Download sequence
Identical sequences K3XC97
PYU1_T014846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]