SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014853 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014853
Domain Number 1 Region: 93-186,375-495,983-1209
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-41
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 
Domain Number 2 Region: 496-512,723-836,889-988
Classification Level Classification E-value
Superfamily HAD-like 7.85e-31
Family Meta-cation ATPase, catalytic domain P 0.045
Further Details:      
 
Domain Number 3 Region: 507-539,588-800
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.41e-18
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 
Domain Number 4 Region: 202-272,333-372
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000196
Family Calcium ATPase, transduction domain A 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014853
Sequence length 1361
Comment protein Name="PYU1_T014853" Note="Similar to ATP11B: Probable phospholipid-transporting ATPase IF (Homo sapiens)" AED:0.0334900117508814 QI:0|1|0.5|1|1|1|2|169|1361
Sequence
MDGGDAAQTPVAASSEYHSLHTSRAQSDQSAKAHMKQPQSTSSSAGANGAPPPLTGTTAP
ITGNSEAGDSENGQNADYRVVPLPQRLPTQPPSNIEEFCSNVVITSKYTTWNFLPLFMVE
SFRKLANAYFLLVSILQCVPDITNTGGLPSNLPVLMFILAVDGVLAIIEDRRRHRADNEA
NSAECHIITATYTGTSTHLKPTQDPDVSVIQWSDLTVGTIVKLRNRETAPADLVILAVDE
TDPSDPNGICYVETKSLDGETNLKLRQACENTLHALTAQQVTSLKGYVRCENPNKVIGRF
DGTLTMSAQSARPPKHQQQHHAPPTSGFSDDSATVQMPLSIKNVLLRGCQLRNTDWIYGL
VANTGPDTKIMQSSVAARPKWSAINEEVNKMIIWLFLFLCALCAAAATAHVVWMYNNQTD
TAYLGANRGYASQWFVTAGAYFLLMYNMIPVSLYVTMSSVMFIQAIFMTWDIDMYYDKLD
VRMIVRSMGLNEELGQISYVFSDKTGTLTCNVMEFRKCSINGISYGTGTTEIGRAALRRK
GIVVADEPLSGSSGTSATKHSAKVPYVNFEDARLMSALERTDRNGGSPEADFFLHLSLSQ
TVIPEVIEGSNEVRFSASSPDEQALVSGAKFFGFSFESRGLGIARVRLRNKSLMINKDAE
SELQEFKILDVLEFTSDRKRMSVIAQYPNGELWVLTKGADNMIFPLLSKSQNSPEVMKET
MRHLETFGDDGLRTLTIARRRIDEKEYAVWSKRFKDANSSLDEIEKRKNNLPNLIDDLMC
EIEKDLILLGATAIEDKLQNHVPRAISNLMKAGMKVWMLTGDKQETAINISYACQLMDND
MKQIVLNCDLFPTQDAVLAHLVEANSQTAHSRQAVVIDGECLEMTLLDDRCREEFLKLAM
SCEGVVCCRVSPSQKAEVVTLVRTTNKDARTLAIGDGANDVAMIQRAHVGVGICGMEGMQ
AVNSSDYAIGQFYFLEKLLLHHGRLNYKRMSVLVGYMFYKNIVMVLAQYYYMVSSNASGQ
KFYSEIAIQVYNIAYTSLPIIVLGVFDYDVPWSVGRHFPQLYLIGPRRELFNNYTFIKWM
CSAVFESLVIFVLVMFGFNDWTSNAGSAPMVQYGLLCFTCVVLVTNMKLIMLQMSWSFYG
GLLWWCGVISYLPLSIILSSSIVSLFPSDYGSFQNTLGHASYWLVIPICCVICLLRHFAW
TAYQRSFYPLPWQIVQESYVLHKGELQSARPVSPSQIDMEAGIPMMNGMQDDDSNNYFTA
SSPKHSERQTERMSSSQHSQKRKERISSSSGFAYSYDPETAMAESYMTTHSIRSVSSALS
EAENRGRKSREDSRSSEYGDSPSASVTDGSRPSHTTAGLFV
Download sequence
Identical sequences K3XCA4
PYU1_T014853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]