SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014867 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T014867
Domain Number - Region: 3-23
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000151
Family Ubiquitin-related 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014867
Sequence length 85
Comment protein Name="PYU1_T014867" Note="Similar to FAU: 40S ribosomal protein S30 (Bos taurus)" AED:0.471509915762491 QI:0|-1|0|1|-1|1|1|0|85
Sequence
MNSDYNIQKESTLHLVLRLRGGGKVHGSLARAGKVKGQTPKVAKQDEKKKALTGRAKKRW
QYNRRFVNVVAGAKRVGPNSNAQKA
Download sequence
Identical sequences K3XCB8
PYU1_T014867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]