SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015041 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T015041
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00000000000000332
Family Sir2 family of transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015041
Sequence length 243
Comment protein Name="PYU1_T015041" Note="Protein of unknown function" AED:0.253959433175882 QI:0|-1|0|1|-1|1|1|0|243
Sequence
MYHMMGPTNLPEEVHWGYTFRHAAMIRYNWAKYRTAPTYAMLKSIRDQFESKIDGSTFVA
TSNADGMFGQEGFPLDSVYTMQGDYGFLQCLTPCRKDSVFDTKAFVDRGLPHVNPETYAV
ENEDTIPRCPNCGGEMFMCVRAGSWFLDSWFKTQRQAYKKWLSSVLDKVRTENKKLTILE
IGVGFNTPGVLRLPDERLAVMDGVSLVRVNEAHPDIPFDSNGVGAAVGANEALAFISQEL
GTP
Download sequence
Identical sequences K3XCU2
PYU1_T015041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]