SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015133 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T015133
Domain Number - Region: 42-153
Classification Level Classification E-value
Superfamily Bet v1-like 0.00275
Family STAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015133
Sequence length 156
Comment protein Name="PYU1_T015133" Note="Protein of unknown function" AED:0.233635472807447 QI:0|-1|0|1|-1|1|1|0|156
Sequence
LIDPASNPDDYYKPPLESYNTFLWRGFGHTDKKRLEAARVEANIPGVKLREFVVLNAIDA
NTRLFVSKSVQHKGDPGCSIYGPASCNAISTDPVRALNTFAVQVEPLAGDANKCVVQLIN
YADYIAPEISAAVMKVLTTDYLPQMLGRMQAAFASS
Download sequence
Identical sequences K3XD34
PYU1_T015133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]