SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015189 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T015189
Domain Number - Region: 98-207
Classification Level Classification E-value
Superfamily Bet v1-like 0.0165
Family STAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015189
Sequence length 248
Comment protein Name="PYU1_T015189" Note="Protein of unknown function" AED:0.192091783695919 QI:84|0|0|0.33|1|1|3|0|248
Sequence
MEADMKPLPPDPEMPILIKPYTLEECQRIVITTYNEILTFQTGYACRESTGANVLGWRDE
RRVLENDQFQFSVRKIFYGRTAAELSLGGWQVNSTPKFRNVYTESIDVTFHVLQQVDADN
VVMYRVLHSLDGLYVNKTLFLTTRLRTETGYIILFRSLDPEGRIMEPKSLATEPEVEADV
GCTDSKKQHRWLNLYSWVIFDEVGENGEHCFFDFNGILPNQSGEWMLEMLLVAMRWENIV
VGPLFTLQ
Download sequence
Identical sequences K3XD90
PYU1_T015189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]