SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015310 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T015310
Domain Number 1 Region: 60-195
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.18e-53
Family P-domain of calnexin/calreticulin 0.00000105
Further Details:      
 
Domain Number 2 Region: 16-54
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000965
Family Calnexin/calreticulin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015310
Sequence length 229
Comment protein Name="PYU1_T015310" Note="Similar to Calnexin homolog (Glycine max)" AED:0.0588235294117647 QI:0|0|0|1|1|1|2|0|229
Sequence
MVSRSSGQAAAHRWFEQNKELVVQYEVKLQKGLNCGGAYVKLLRANESTDFKTILRTTTP
EIDDPNDTKPGDWPDESKIRDPNAVKPDDWDEDAPARIPDTDAVKPADWLDDEPALIDDP
SVVKPEDWDDEDDGEWVTPQIPNPKCENAVGCGEWQRPTKANPAFKGKWYAPLIPNPAYK
GEWEPRKIPNPDYFEDAHPARLDPIGALAVEVWTMSDGITFDNFWLGND
Download sequence
Identical sequences K3XDL1
PYU1_T015310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]