SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015315 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T015315
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily DNase I-like 0.0000368
Family DNase I-like 0.049
Further Details:      
 
Weak hits

Sequence:  PYU1_T015315
Domain Number - Region: 109-196
Classification Level Classification E-value
Superfamily t-snare proteins 0.0785
Family t-snare proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015315
Sequence length 223
Comment protein Name="PYU1_T015315" Note="Protein of unknown function" AED:0.0353226817042607 QI:1|0|0|0.5|1|1|2|2|223
Sequence
LDSSSPDLHYDPGRSSCLEWLAKLGVVDAWRIHYDTKRVFTGPLPRKNRLDYILLSEDFY
TRFYDDSKYFLPKHAGDHLAHSVSFRSGLQLHGRGYWKFPRYLLEYPLVVSAIEKEAEMV
LDKLRTSTYPGKIWEQWKASIKTQLQDVQKKLRMQDTVAIEAAQAVLDHAAARYRDASTE
SNRSEFDDAMKMYKETVTRTSQYNQDTAFDFQAANSEKLTVPF
Download sequence
Identical sequences K3XDL6
PYU1_T015315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]