SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015323 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T015323
Domain Number 1 Region: 22-286
Classification Level Classification E-value
Superfamily DNase I-like 9.81e-25
Family DNase I-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015323
Sequence length 549
Comment protein Name="PRED-EEP1" Note="predicted endonuclease/exonuclease/phosphatase" AED:1 QI:0|-1|0|0|-1|1|1|0|549
Sequence
MARFAHLVLGAALALTAQRVVAADGVEVHVMSFNIRTSDASGDAGGTCSNWNGVRKDNVV
AEIKGVLPDFFGTQETSDTQKAYLDSQLADTYTAIGTSTGSLNGAASEVDALYYKTAVWK
LITNGQFWYGPNPDTMSAAWNMQYYRTGVWGRFEHIASGQTACIMNTHYETPGNDEAQIQ
ASNILLAKIDALCQATDKLIVVTGDFNALPNYPAIIKLLQNDLAEPTLDPTFCGDMLSPT
CQTKFDYTLHRLRDGACYKKSEVLRTAFNGCYPSDHAALLGTFCFGGSCCGDSSSSSSNS
SSLADSNAGGGATGMSSIGGEQNTSPGTVGPSTGSKGSSSSSSSDGTTQVSTSKSETSSN
ATGTVFLVLGVVGATAGIVVVVIRKKKELDDKVQGSKNDSAQFAPSYFSRVDDADNAALS
PVASPRMSGPSPGRMSNSPGRLSTSPVPTLMATKRDSKRDSRSSSVSCTDLSPSHYNNVR
TSSNASFGNDRISSPAMMGNESSIYSSSFSYSSGMHDSRINFSEAFAPESFDMDDNKLTQ
PKKTDFAML
Download sequence
Identical sequences K3XDM4
PYU1_T015323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]