SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000213 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000213
Domain Number 1 Region: 47-252,286-445
Classification Level Classification E-value
Superfamily DNase I-like 3.17e-63
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000065
Further Details:      
 
Domain Number 2 Region: 567-585,626-768
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-21
Family BCR-homology GTPase activation domain (BH-domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000213
Sequence length 853
Comment protein Name="PYU1_T000213" Note="Similar to INPP5B: Type II inositol-1,4,5-trisphosphate 5-phosphatase (Homo sapiens)" AED:0.335327801166899 QI:0|0|0|1|1|1|2|0|853
Sequence
MSFSMLGGPPSTTSTSSSRSSIGSVASSSSLAANGKYYNPVVMSFIRDDWVQQQLRLRQH
AYTAFQKTSVVVGTWNVNAKKPLAQAEAAKILLWIQQQQQASGSPQALPDIIALGFQEIV
DLNAVNVVVNSTVSAQRSSAWEESILYALNNHLVGPQQQQKYKVVMEKHLVGILLLVFVK
SEHFQHVKEERGATAGVGIMGMMGNKGGAAIRMNFYDSTLCFVCAHLAAHRENVSGRNSD
YANILSKVEFADNDDGYGNDTSSAALSPTCCFVYDGDVDDRLFNGEPAILNHDFVFWLGD
LNYRINEDIPTEAVFQHAESGVYTELLQRDQLIIERKRCNVLHGFEEGPIKFPPTYKYQA
GTSMYEKRPEKKLRAPAWCDRILWKAKLPEQVMLKHYNAVSALDLSDHKPVHAFFDVEIR
HQVEAKKNQVLREIMMQLDKWENENMPKVRLIQSDGVQLSSGMLGYTHLKYGLDQTKTLF
VENTGVVVAHFRFIPKLEETLLCKPWLSVSPTFGMIPPKEKMEIRITAHVNEAVAHGLTS
GTETLDDTMILRVENGRDYFLVISGQYDNSCFGNSLEQLVVNSEPVRQVKHLLANAAGSS
MFSVGGSGLSNPILPQSQRAEDPSNAQKIPKELWRMVNDIYQNYMNEKNLFVEAGNKQEV
AILREALDTGRAFPAHSGYSTAELLIGWLQSLRQSVVPNETLTNAVVAGNGNVAQSCCVL
LDGLPPVRFNVVVYLVSFLKELLKHRNTNKLTPEKLAFVFSRCLVSQCRISQDLNLMQGT
SSGDSSQPSSSPPYSGSSNASTASCSSNQTSMLLPEDKLRRNAREIEIAQWNATQRGEKM
EHMLLHMITTSTL
Download sequence
Identical sequences K3W5H2
PYU1_T000213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]