SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000218 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000218
Domain Number 1 Region: 66-118,146-401
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.59e-65
Family Papain-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000218
Sequence length 507
Comment protein Name="PYU1_T000218" Note="Similar to SEN102: Thiol protease SEN102 (Hemerocallis sp.)" AED:0.053554123042312 QI:1|0|0|0.75|1|0.5|4|2|507
Sequence
AQAAPQQVDTSDAQLLEHPERRLDTARVQIDEFESTLHNKQTRSRRRASIGPKRASPFSR
AHAIETSRRIVNAHNKQQREGKSTYTMAMNELSDLSPKEYRSFLKAKPQVQATAHGVHIK
KPHGSMHQHSKQEMKAVTVVTSTATTTLDVNVNATIPKEINWLTIENGKYMTPIKNQGTC
GSCWAFSGITVVESRYAIENNVQASPLSVEQVLSCSAPLDHIHSKFSKDMISSSEGCDGG
MPFLTYEYMSLMSPHGISCADSYPYVMATTAGETVCQSVGTIDVAVQWKNDSSYVAVASN
DEDALLRAVMSGPVSANLDATGDGFKYYESGIYDAKDCSSNGKEVNHAVVVVGFGETEAG
EKYWVIRNTWGTMWGENGNMRIARGSSANGPCNLYLYSSYPVNLSKGSASASSANGATCA
VVSESFTAALPMSAKIGFDLLQGLLLFGMTVVMLGGGMTFYWITERQFNIKEAAGNLRYE
DNYRRWLLPTREQIANRVTRRRPAAEV
Download sequence
Identical sequences K3W5H7
PYU1_T000218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]