SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000648 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000648
Domain Number 1 Region: 953-973,1042-1266
Classification Level Classification E-value
Superfamily HAD-like 2.75e-48
Family Meta-cation ATPase, catalytic domain P 0.00017
Further Details:      
 
Domain Number 2 Region: 763-845
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.22e-19
Family Calcium ATPase, transduction domain A 0.006
Further Details:      
 
Domain Number 3 Region: 419-494
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000000209
Family HMA, heavy metal-associated domain 0.00085
Further Details:      
 
Domain Number 4 Region: 684-742,846-948
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000811
Family Calcium ATPase, transmembrane domain M 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000648
Sequence length 1311
Comment protein Name="PYU1_T000648" Note="Similar to RAN1: Copper-transporting ATPase RAN1 (Arabidopsis thaliana)" AED:0.0457382421154686 QI:0|-1|0|1|-1|1|1|0|1311
Sequence
MARKKSKHTTKAKSDGSHAMACGTEDAPLKDAESTPVLTPSSSSPASPSSDSNGKGQESA
AATLKITSAFVMDEGVKMNGGDVETVVLAADLEQGHVEVNLCGEDHADEAVVVESNGGKQ
ASGGCCSSGNAATENGETVNCKPSCSSLKDAEKSAGSCCSSKEEAVVEVVVEVPVKTSSC
CGSSSCADAPVSSDANGSADVAEAVKESCCSSATAKTTSAGSCCSSEQMPAAVSNGVLEK
ERSCCDSPSNAEAAEAPKASCCSSTAAMKSTGSCCSSKKAPASEANGVPEKKSSCCSSSS
PAVAVVASPASVSGCCSSKNKESSQADSCCASKDPANTVTTIVNGSGCGSLAGKSDSCCS
TTKNGGARKIMERKPSNSHPDRIRERLLDRVTEFKNARGISMAQHHLAPRKSVAVSIKPA
DLPTLRLSIGGMTCSGCCTRIEKFMERRPGIMGVNISLLTSRGVFEYDPKMVSEKAIEDM
VVSLGFTAGVMPNESFVSIVLHVGYEHPAKVCAMLLEMQGVVSAKETEDVTLTTSPKLAM
GAQTAVLVEYDPEETGARKIVRQLSGAVGFQVYASTPRPLAVQNEEAEVKKFKSFLMASF
ILSLPILIMEYVLPLFVAAESNPVERDIVSGLSYKDAIGMVCATPILFIIAFPIHESAFL
ALRYSSRVTMDVLISLSSFAAYTFSVVTVFMGIFHVHPERSETFFEVTALLITLILVGRY
IEKIVKAKASNSVDALLRIQAKTAILLEANGGNDKSMKESYIDILLVEREDLLKVLPGTR
IPTDGVVIEGASTVDESMVTGESRKVAKEPGSNVIGGTMNSQGVLIMRVTHTITESMLAR
IVNLVDDAQSSKCRSQSVADVVASYFTTFIISISVIMFFVWYHLARSGHISTHGWEPFPF
ALRFAITILVISCPCAISLAVPTAIMVSSTIGSQFGVLFKGGQAIEALEKVDVVMFDKTG
TLTSGNLAVVDVIIPTTNVPEENARKLWSYIAATEKNSEHAIGKALVSYAHQLNAPTLSV
VKFDSIPGCGVRGFLDDSLQVSIGSLKWMQDALKIGVPVDLHMANSRFQQHGYVVVSVAI
DNQLAAVIALRDTPRPEARFVIEQLRRKKIQTWIVTGDQRETALSVAEMLGIPEFTVIAD
ALPHQKVDKVRLLQSIGKNVAFVGDGVNDAPALAMAHVGIAVGAGTDVAIESADLVLVKD
DLRDLLNSIDLSHATNKLIRWNFTWGFMYNVLMMPLACGALYPYFGVSIPPALAGLSELL
SSVPVILFSLLLNFWKPPYKSHDDVDPEQAFVVVQVDTYSANEKTPLLVRK
Download sequence
Identical sequences K3W6Q7
PYU1_T000648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]