SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000670 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000670
Domain Number 1 Region: 149-397,442-517
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.46e-54
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00047
Further Details:      
 
Domain Number 2 Region: 31-121
Classification Level Classification E-value
Superfamily RING/U-box 7.42e-20
Family Zf-UBP 0.0055
Further Details:      
 
Domain Number 3 Region: 402-439
Classification Level Classification E-value
Superfamily SAP domain 0.00000293
Family SAP domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000670
Sequence length 519
Comment protein Name="PYU1_T000670" Note="Similar to ubp10: Probable mRNA-splicing protein ubp10 (Schizosaccharomyces pombe)" AED:0.0771122320302648 QI:0|0.62|0.33|0.88|1|1|9|0|519
Sequence
MKRSLEESGVAAEDGNDHGGTDSNNNNKRRKCPYLDTINHQMLDFDFEKVCSISLSDQNV
YACLVCGKYFKGRGKATHAFTHSVQSAHHVFINLQNDKIYCLPDNYEVVDHSLQPIKLAL
RPSFEPSQIVKLDQNRILAQDAFGVSYLPGFIGLNNLKNTDYINVIVQALAHIPPLRDFF
LQSSDVVMKSKSQLVQRFGELLRKMWSPHNFKNTEVSVSSKKRFHVGKQNESVEFLSWLL
NELHRGLGGSSKPGSSVIHKCFQGFVQVTTVDESKAAVVDPSDESKRALATTTAKSPFLL
MSLDLPSTPLFKDSQGGNIIPQVPLFTVLEKYDGTHVTHVLQGSQRLKKTYKIESLPPYI
IFHVKRFTRNNFFIEKNPTIVNFPIKNLELREYLNLDGSIPTEELGAMSIADLRAILTKH
SVSSKDCVEKADLVEKVLRVTVPSTKYNLIANIVHDSPVTTGKEASLKTNPLTEGSYRVH
VQNRATEQWYEIQDLHVQETMPQLIGVSESYMMIYERKA
Download sequence
Identical sequences K3W6S9
PYU1_T000670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]