SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000722 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000722
Domain Number 1 Region: 125-226,257-329
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00000000179
Family Lambda integrase-like, catalytic core 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000722
Sequence length 658
Comment protein Name="PYU1_T000722" Note="Protein of unknown function" AED:0.0146818622491991 QI:2|-1|0|1|-1|1|1|1|658
Sequence
ISDEPERVAGCKLRESGKRCCKRLYALLSSEGMTWENAKRHVENDASGESLAAIMDSFGM
YLVRIEGKQGKLLARHSVMSYFRQVKNWLLDQFHGQKALVDDRLLKMARTLERYSLKRES
GGMVKKANACTKEDLELMMLYLYKTAANPTDYQDAALLALLWYLFGRAPDLLLLQKQYVS
VCSRNVFFLRFVRVKTAEEQGHTLFPDRNFVTCPLLAIALALATQRCASPSLLDHLSDVQ
HEEGCDALPASISLMERLLGSTAAVDGTKGRAASVPGVHSYVNRLLRRIAAKAGVSKPLS
LHSFRRGGAQHANGEPDVSLQWILDRGAWNLSTTNKAFAYVFNTTSEDKKIAKVLSGWRP
GDKAATVDLGFVDAATRERIRRFQLLLFPACQGLSTAAYNINATALDVLTAQLLLHYPHL
KALNEASPGVRRVEECAAQAKVEIAELLEWSCALEQQSSACEHKKASKEESNIDKALQRQ
MALTEQLIDQNEALSKRVRAIESGNEPTEETPAAQEVDKAVNKAPKRARKSPTTHLSDAW
FEWYTSEPRLCVSGDSKRKSLLKQAVGFMKLFLVDGFTLNESAADYKDRVLEYGQQAENE
AIVFLRTKRIESRGVGAVVRHFRELQRAGHLDGAVRHYRSLVAVERIQDPAPSHTNPQ
Download sequence
Identical sequences K3W6Y1
PYU1_T000722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]