SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000783 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000783
Domain Number 1 Region: 59-209,240-288,316-422
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.02e-57
Family Papain-like 0.0000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000783
Sequence length 486
Comment protein Name="PYU1_T000783" Note="Similar to CTSL1: Cathepsin L1 (Fragments) (Gallus gallus)" AED:0.278520849224914 QI:0|-1|0|1|-1|1|1|0|486
Sequence
MRALCVAILSSSVAMAETHSFGTLLQCAAGSRCLWAGADGTPVVSDEIVRQMMESEGIDG
DEEKQRLEEHMRYLEAVQMHAAEEGLAFTYKIGVNARHLYLDGNRKLTAKQFVRQEVHAQ
TRRRLEEAEEAMQVKPEASRRLAVTLPSTLNWCSTDNPLKRNICTSVKSQNKCGSCWAFA
ATDAIETAVAVNSGNSPQALSPQQFLDCSKREMTATFEYCWAASGAKGATWLQPEMKWGS
QNNVCDGGMTHGAFQDAAALHLSLMTELDMPYKEVDVVTLNPFKTTTTKAPSVSSANATC
ENDSTKAAASINNWEQVVGKKCDNSTDATELLKIALQQQPISVAINSGSNFKDYKGGIYE
CPNSGDFTDSSEIDHAVVLVGYGTDGSTDYWILKNSYSPQWGDKGFLKLKMDSKINCGVN
VFPVIPLGATAGAVKSVVDGGGDRLFLGFAPGVWIAAAVVVSIATIVLTVIGVIVSNRRR
AAMLKQ
Download sequence
Identical sequences K3W742
PYU1_T000783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]