SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001003 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001003
Domain Number 1 Region: 2033-2344
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-74
Family Calpain large subunit, catalytic domain (domain II) 0.0000526
Further Details:      
 
Domain Number 2 Region: 2346-2487
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.12e-17
Family Calpain large subunit, middle domain (domain III) 0.0049
Further Details:      
 
Domain Number 3 Region: 78-188
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000151
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 
Domain Number 4 Region: 2579-2611
Classification Level Classification E-value
Superfamily WW domain 0.0000159
Family WW domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001003
Sequence length 2613
Comment protein Name="PYU1_T001003" Note="Similar to sol: Calpain-D (Drosophila melanogaster)" AED:0.0344299923488907 QI:0|-1|0|1|-1|1|1|0|2613
Sequence
MAHPRSCRQRAAAATILQRLHVRLLTLVYIGAVVLTPHVLRAQTINEVGYPDPRYSKTKA
LTRFSCTGGPSNCPDGGEYAAAGGNLTITIIEMRNLPNLDGFGKAGLLTDAYIEASIGDN
VRRSAVISNSLDPQWPPCKNNGCTGENDKMRDLNFGFRPAGTEITIKVYDEDSGFEFGDD
LIAQVTVNSIYCSGFTAISQQTISADDSKWKMPQQPLCVEEIWIPLTADGECTSSNGIFT
STTTPCMRLRMTALPFQVRVEQVFLSGSVAVSGGMGGYFPNEDSWLYGRVYSASDTRMLS
YFRMDRSKGGLLVRSDSASNNNKGNAALIPKYGYTPYAQFTINFDAEVFVFRRVDDAASA
PEWLNTTFGWADTREYAQLMDVVGDFKAVAQNFSAHTVNEYGDAFQHGIITGMNLNQAFL
DKTLSMYFIIASPHESFDVVPATYSKEFSRGVFVKLAAQFLPNFTFLAILVLRYLKRMNW
RIERVHSFLAEKVVEKDKPATLSTSKAEASLKLDIKGAAANSSAKKSNVAIAGAGKKKKK
DIVALLFLCYNESPQNLEFRRNLFYATLALSTIFVSPVLILITWGVTSILLVAPPAVGFA
LIFLGVGALCTMYGLVRWIKLGWRMTDIILRLFALAFLFAFVFLFSATFADPKVFIGGED
LDFFSLSSIFLTLNMMPMIWIAFTNDSKITKSLSQIVSAVSATKKVNMLKTKFKNLGTLG
LKLATAKGQQQQESAAEQQKQSLKRSRKESVFAPLMGDHYTVEQSIPGFNRADILNNAFV
TSAETRRAGNRRYYGGSIGILVIYCIVASVRSAYPTQAMGIAITVMLVDLCIYMLSRGFL
SWSAGYIVFLMSCVRVCLAATSGEYWILGHAFLYMVFGTALCIEIIGKNLPRMNKQEAGG
VTFFGHDQMQWRHFDMSTTPEFVLGFLSFFYIFLLLAVAFGTEANDTIRVPVAGQKWPLW
IFGVLAFIVVLFVGLSLATSRAFFLQKEQLLSEYATKVYLFVRAFKLPFMLAAASEVLVI
CSGMFVYASTQSSFILVTSIFGPLILMLSLAVYAQWRKNDYRLVIWPPEDDEEDILDEDE
DFDAEDALEKEAEIMRETFVLPPLKGKGNTSIYDSADETFKMPSLPPKNVLQGKFAPGTK
PMEIKGPATMANKLGSTPAFGKSMLHSRKQTQSKEALNEELPSQPSNSSGGGDLTVILGG
GPTEANAGAPNAPLAMKKAPTRRFGLLRDLLARRIGLRTLLSKQARRKYKEVGNLSPSNS
AGSPRGGSSEPLLNSPTSSSRRQSSAINKESDVDFAVMSLYDAYRQGFLLPSDYVTLGCF
AALLGLLFLYGAIISFTEKPGWLGHLLWVAGYVVLFSLFPTIKYFKIASVKADMKYAFGA
SYLLAWITGFIIFFHVMKQNVNEIEALIILSILVFYPIFLLFIVTLLKWKDEDYEITRPI
KRIFGFCMAAISLWIFEMYIFAGVVFGVVLTFLLLLFLFITYFLVKWVENDMYLSPMYQR
RANLIIVGSTIIAIGIGLFVGLNFFYCLSIVFIVLILKYAAHFAASWFVAKDEVSIFYSP
YLFPVFSYNAYTNNVVDENQSIKYLYLIFFLCFSWGVSGVMFFDPLGFGVGLCSLVLLVF
AGVTAHLCAVTPVKMGIASKYVNEMILKDASTAAKDVSEKRRKPFTLESTEFIELEKRER
KVELEFQAIAYGGGAFAKKKNPFDKAKQGDVPSSANEDEPEPTSRRSGGDIAMEIEALER
SCHVQIVGGLEVALPDGLLTIKDILYEILQLATGPFGFLYFFTLPWRLIQFLRWKYLPAR
WSRSSRSQPLQDQLDLVEKGDLAYLKSSIGEPSDLVGILMELPVLDEELDREFFEETRCI
IHFQLLMLNAADARLSREKILFQKFLRENRFKLMSNGINPPANIFKTSSFASIDIPLVAV
WLISLTPEERTRFHALKAAFNKEMERVDAIIDAEDSQSRLAQNELREYWKSHEEAQCRRR
MQEFHARRMRRAAEGILPEELANQDETILNAQEAIMEIESGYSCTPGEFGRALQFVDREF
PPDQTSIASCTHESDVVGWKVSTAINVVAGLFDGGTDPDDVMVGKLNDSWLLSAISIIAA
SGGIDDGKVDALIDNMFVTKQTSLTGAYAVRIFKNCQWETVIVDDHFPVLADSFKTTECA
GAAFAHSKNFEELWVPLLEKAFAKYYGGYASLERGYVHHALKDLTGYDSEEIFLAQASRG
SLKRTLWNQLLIYKANKFLMGAGTIMGENADTEILDTGLVFGACYVIYDVREIDGYQLLL
LRNPPGDHDEWKGDWSDCSHLWTRRLKKLLKWNPDSDDNTFWMNFDDFCHAFRSLYICRY
YDPVKWPIQVVNGAWHGDTACGLPTRHNPDCTLECNPQYSLSISRPTEFMVTITQVDPKG
LAPVTVLPIAVYIVAQGKQKDRASRVKALTRENVVAHSGEPVRQREIQIHCELEARTYTI
LVVAYKKGMEGPFKLKVQSNYPVVLEQLWPAVWKDPSKATIAEKMASKMKETVAESSAMT
KILEKKNELVSKIAAGAAVMDNALRDDETILKEELAKQQREEAETAAAAQTKSTKKADVP
KHVWIEQWDENAGKPFYFNKQTGLSSWEKPPDF
Download sequence
Identical sequences K3W7R2
PYU1_T001003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]