SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001024 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001024
Domain Number 1 Region: 78-248
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-28
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 266-323,385-430
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000374
Family Fibronectin type III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001024
Sequence length 432
Comment protein Name="PYU1_T001024" Note="Similar to cenD: Endoglucanase D (Cellulomonas fimi)" AED:0.366659093066129 QI:0|1|0.5|1|1|0.5|2|0|432
Sequence
MAPNGSSNYAEVANTAGTTPINVLEILRIPGSADLPLLPETRYDFKAIAVNNVDICLAMP
SSLEPAAAVSAWTSAVAVPGAPPAPYFLSATGGQIVLEIVPPTNMNGSILSGFSVMVNES
VYDFVVAEQSVTHSIQFLMASSSYVVKVAATTNLGTTAWSDPITMATTAPTSPSSPQNVT
ATNITASSVTLQWSIPLDSGGADITGYDIVTTTAGSSATKHATTAPFEITGLVAKTVYTV
EVTAINSLMKGGSRIGRQGISFETLTATAPSEPWGLTSAAGTGGSIEVSWNVPLQSGGTN
LNDMLYNVTMFSIVPCYSLATEVDPCARCDIVKLQEGNEQYRRIIGANDRCKRPSTNQCP
DGTSNCCLMSGVDSTALQCSHVAGVDRYRLALGSNSTVFQGLNHSTTYHFGVQAKNLIGA
SGLSTIAGLRTT
Download sequence
Identical sequences K3W7T3
PYU1_T001024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]