SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001045 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001045
Domain Number 1 Region: 283-391,424-647,768-827
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.3e-27
Family Hermes transposase-like 0.03
Further Details:      
 
Weak hits

Sequence:  PYU1_T001045
Domain Number - Region: 208-245
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.00103
Family Hermes dimerisation domain 0.0093
Further Details:      
 
Domain Number - Region: 29-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00833
Family Classic zinc finger, C2H2 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001045
Sequence length 890
Comment protein Name="PYU1_T001045" Note="Similar to ZBED1: Zinc finger BED domain-containing protein 1 (Homo sapiens)" AED:0.0304876681688275 QI:0|-1|0|1|-1|1|1|0|890
Sequence
MRRPELWQFIRLVVPDPPTVAAGKKYTNQDAKEAYCLKCKRMMHYNTGSSNNVSRHMAKF
HPADLASYEMKMSEKKRQKALQQANNTHQQHSANANGDGSSNTGGRKRKLQRTDHHGSTA
QSAPFQLIRHGDDGFSNAADVDASGHGVVADADTWSADSDDDTGGSKPMIEPATSTVVQA
HGDASLLSKLHDPGPSSADAVVSSVVETEKLNTLIAKWVCKHYHPFGITEDPEFQAIINF
AINMKKSVSLPLPPQSEVRASVESLSARTRLDILHQLTSEVLYFSIATEFWTTTERDVFI
SFSIHYLTEQFDWRHFTLDVREYNGHLSPEERKEQVDMLLTRWNLDPRCMNTILWDSYNP
PPTENEFIPHHTQQTESVAHVIQCIISPIFHAQKELTMDDVPLFFVDEQINTLVSRIPAE
FQHGVHFLREYVGVFRDLAWFLTNHPRAVVWMSKFMAGSAQIRLIVDSKSNWLTTVDMLR
RLMRKKEVIRDFFAYIETSEGRLEFQHSGIFSRTLPGNEQWCAIECLLLLLQPFESVAVA
INKEKYASSCLALALLRFLKRDLEKANDFARIFAIYAAENSDDDIQFKQKIAASIDVTRK
FLHGRFLEHFDKISNEYMWISQLDPRFVRMKYLSDAERENCKTRLVERCLGLTNALQNQK
CNTTTGGSTAMHESAASSSVFLDFQTNKDDNDTNIFLRELLFDDNNEEGTLPPQHHHHHH
HHLHPNHHPPSQNDLQQQHNTNSAALATATSAEMTGMMHAGSDDINQPSFEEQQANLRQQ
IVAEVDLYYQSAAVARVPAVRDPLQWWRENAPRLPLLAPLARKWLAPVGSVRPTETLEIP
STGMATSLSLGGSGGAAPTHHHANGAAHHYVAVHCDPELVRDMVFVHDNC
Download sequence
Identical sequences K3W7V4
PYU1_T001045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]