SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001112 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001112
Domain Number 1 Region: 128-601
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 6.28e-161
Family Trehalose-6-phosphate synthase, OtsA 0.000000214
Further Details:      
 
Domain Number 2 Region: 631-811,844-861,919-942
Classification Level Classification E-value
Superfamily HAD-like 3.98e-24
Family Trehalose-phosphatase 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001112
Sequence length 985
Comment protein Name="PYU1_T001112" Note="candidate bifunctional a,a-trehalose-6-phosphate synthase / trehalose-6-phospate phosphatase" AED:0.0632762672037597 QI:0|1|0.66|1|1|1|3|21|985
Sequence
MDANDLSENSSRDVIVTAFTGEAQGDDDVSELDRSSCDEASGSEADSDDQDTPTPPRSQT
MYRANSPRTGTMRTGFTYEDEDVTEMNAREQELLVGIQELQRQLSMVQIQTEKPQEEILP
PATDSRRRLIMVSNRLPISFQKNETTGEWSFKMSSGGLVTALNGIRDEVPFIWIGWLGEE
IAQEDQNKVREKLAKEFNCVPVFLSKEIAERYYNDFSNDILWPTFHYVPLPLFKAGSEKK
FDFRLWDAYKLANKRFAQAVNQVYRDGDYVWIHDYHLMNLPALLRKRHPRCKIGWFLHTP
FPSSEMYRTLPVGKQILEGLLGADLLGFHTYDYARHFLSACSRIPGATTSPKGIEWEDHF
SSVGVFPIGIDPEHFEGILEKPETQTRIKDLCEKFAGCKIIIGVDRMDYIKGIPHRMLAM
ERFLSKYPERRESVVLIQIAVPSRTGVEEYQQLAASVNEMVGRINGRFGTLQHTPVHYIH
QSVTPTELVALYNVADVCLVTSLRDGMNLVSYEYVMCQSKPCEGRREGPGVLILSEFAGS
AQSLSGAIRVNPWNNTDMANALEYALTLPAIEREYRQSNLHRYVKTHTASFWGKSFLTEL
EFAVSRPSLTKKLVKLPTMDVINAYNRSKKRIIVLDYEGTLLDESHQRSTIAPPKAVVKR
IIENLAADKKNTVLLVSGHDRSVIGSWLNDKRIGIVAESGYCYRLPHEDEWETMAEDMDP
SWKRVVRPIMQYFTERTPGSRIETKESSLTWHYGETDPIFGPMQARDMQINLEDVLCNLP
LEILQGTNRVEVRLQGITKTVIIEEVLKQFYHAQSPANTPSSRATSPPSRLKKPQQEKQQ
VDFVFCAGNGLEDDDLFTFFKEHQELAKKASQSAVPPAPASAASTTPSGLPPLPPPPPLE
FTGSSAIMSSALSNKANVFTCHIGANKTEAMYYLERPSDLLRVLRAMSAHSREGFMGHED
ASAAMDPLVTAIPATGPAAGSSSST
Download sequence
Identical sequences K3W821
PYU1_T001112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]