SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001161 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001161
Domain Number 1 Region: 151-429
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.12e-60
Family Calpain large subunit, catalytic domain (domain II) 0.0000387
Further Details:      
 
Weak hits

Sequence:  PYU1_T001161
Domain Number - Region: 598-611,727-733
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0419
Family Di-heme elbow motif 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001161
Sequence length 813
Comment protein Name="PYU1_T001161" Note="Similar to Capn9: Calpain-9 (Fragment) (Rattus norvegicus)" AED:0.179439639078828 QI:0|-1|0|1|-1|1|1|0|813
Sequence
MLDDDKKLVCSMAIKSPAEAESILQVIRQNPSSVDHSFLKIAKDAVTTGLNKRKRDHLLL
CTKNMITHLSEFVQDGLQRFDLMWEKSLLDHYKPLTFSGVGDGSGYRVDMSESGVVSRVS
VLVPIYFQAQGTCLFDRSREAGSANRVSGVGIAPGDLRVGRLADSYLFGAMSILSTSPNA
LAQLFPELDGDLIIPDRVEVGTMFPREQQYNDEGIYAVRFWRNNRSRIVVVDDYIPCSQF
GKPVFGSFTGSNGKFEIWSLLVEKAYAKLHGGYEAIVGGQETYCLQDLYGGVPASFKLQE
KYPAEEDAWHAISKSLQSGSLVGCSNEDVEMDLPKGLRKSFAYGVMKLVELDYKGEYVRL
IQLRNSWGIGTHSQPDKWGGAWSSDDSKWHSFSRIQKVECGFQFRDDHTYWMDFSAFYCF
FSNIIESRNLFNFRSVPDGVGNPINPSLSIHIIAGEWNGITFGGRDAMHLNPQYQLFSPA
TQGCELAVVLEQPSRRMHMLNEYKSYIAPVVLKNGERMQRKIDLSHDVIATGTFISNRSC
LLETSLDIPGQEPGKPFVVVPATYDGHLPYALEYSLTLFTTKPTAIVPVSDTATLPICVV
CQKALTGTFRTFTHSENGQTQVDRVCKDTCVDIYRERNTPVCVDCHFRIEVIEGRFSGRM
YTLPDGATVHAECIDAYQIRVAEKCIHCGQAIAAIPGRFDGKYYEITGGKVHGECMEAYQ
MSTAKRCVQCGEPVVKIAGRFDGRFYKIQDEQLVHFECWDSYQMAVAPKCVHCSQPVVQI
PGRFDGRFYDLTNGLGKVHFECWDNYQATVSRR
Download sequence
Identical sequences K3W870
PYU1_T001161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]