SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001328 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001328
Domain Number 1 Region: 15-327
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.22e-74
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000922
Further Details:      
 
Domain Number 2 Region: 367-526
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000000000017
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001328
Sequence length 632
Comment protein Name="PYU1_T001328" Note="Similar to cysS: Cysteinyl-tRNA synthetase, cytoplasmic (Dictyostelium discoideum)" AED:0.0174227754378298 QI:0|0|0|0.66|1|1|3|0|632
Sequence
MREPLPRANAVVPNVLKWYACGPTVYDRAHLGHARAYVSQDILRRILEKRFRYNVFLVMG
VTDVDDKIIKRAQERKIHFAELARDEERAFFEDMEALYVQPPNTITRVSEHMSEIIEYVE
KIQKNGFAYESSDGSGVYFHTKELGDAYGKLDPMRNAHVSASDVQASDVEDDDAASMVTA
KKDRRDFALWKASKEPGEPSWDSPWGPGRPGWHIECSAMTHHVLGDKLDLHSGGIDLRFP
HHNNEIAQCEAHNCGVDHYHHHPEWCKHFVHFGHLYIQGLKMSKSLKNFISIKEFLEDHT
ADQFRLFCLQFKYRSNLHYSEDRIRDAVVLSDRIKSFFKSIHAYGSERSSASKSKKCDDM
DLNLLNTLFATKGSIDAALRDDFNTPLVLTLLLELISRTNQYLLDRLDAPSEVLGSVAKY
VLEMLDLLGLEGLHREFAHVEQLFAITSTPRVTLAASSQTAESSALGSSGEDILRALVRF
RAAVREEALKNPAASHNSAILKLCDAIRNDELPQLGIHIEDLAPGRSIFKLSSKEEREAA
EAAAIAAKAEAEALAAQLRAKQQEFEALMQIAPVEFFQKAPEYTNKFAAFDANGVPTHDA
NNELLTKSQLKKLQKKRDKHEKAYTKYWETKP
Download sequence
Identical sequences K3W8N7
PYU1_T001328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]