SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001861 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001861
Domain Number 1 Region: 1029-1381
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.3e-28
Family Glycosyl transferases group 1 0.018
Further Details:      
 
Domain Number 2 Region: 770-867,919-979
Classification Level Classification E-value
Superfamily TPR-like 8.26e-23
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 3 Region: 35-69,119-241
Classification Level Classification E-value
Superfamily TPR-like 3.29e-19
Family Tetratricopeptide repeat (TPR) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001861
Sequence length 1386
Comment protein Name="PYU1_T001861" Note="candidate bifunctional glycosyltransferase with two catalytic modules" AED:0.0457320505848406 QI:0|0|0|1|0.5|0.66|3|0|1386
Sequence
YALGRPIQIQAPEDKEGLAQHAVELYRDAISAIASNVSRAIQLFQQSIETYPLAPAYNNL
GWLLLKSDAHGHGKHAAMVALERGAVVATEANDTATYADIQTNLGHVVRSRNPRSVASCL
EAIAFFDVALQAVPLHVTALYNKASALFAIRQYHEAEVLLRRALEFEPSHTFAHLDLGLI
YYARGNLELALKHHDLASANANSISQRANVMTNKANFLLKEGFAADSLAIFEEMRVLKPN
GALELAHVAMAKRVLCLWDGVEDLHDRLVQSVEHELRTAAVEAGSSLYPFDSTLLRVSDA
FRKRVATATAKRNDQPVTLELFPCALTLAAPTLLPTRPQKRLTIGYLSYDFRDHPMGQLI
LGFLENHNSDLVQRNCYSYGQDDESEWRARAMAACEVFRDIADVSDLGTAQQIAIDKVDI
VIDLMVYTTGTRSEITALKPSPIVVNYLGYPGTSGASTINYVIADRFVVPPERVQSSMSE
QVVYLPHTYQSNLYELENNEPCLDTAIYVGDGDADDKKRRFVPIMCPLAKRSDYGLPNAA
IVFCNFNTINKYEPVAFFTWMRILHRVPGSVLWLLEPSSYNSETIMDTLYREALAHGVHP
SRILFAAREDKSSHMTRLTLADIFLDSFVYNAHSTASDALWANVPIVTLWGDAFPSRVAA
SLIHNAIRFPEIVPHSVKEYEDLAITLAHNPVLLRRIRRELASQALASPLFDSRRTTFNL
ETSYEVMHDLTHRMFPHCQKDKRFHALVNPEASRDFDIEANTKLRLQRALERGIVHHQNG
QLKQAEYYYLMVVQVNPKYTDALHLLGTLYFSRGDVDLAQSLLRRVVQESPDVVLYHLNA
GLVYASLGNTQNAVTELQYVLRLEPSNVTAIKKLLEIFFNNLDFENVVQLFQSYDAILFA
TSAVHNSSNKDSEDHAVQEKAYLQYSYALLKTGRSVEAIEVIEGALVDHPQFFRAAYNLL
SLYADQQMYPSADALLVRTVRAESHANFRSKGVRFPKLPRPRGQRVIALYCHEYGGSWWG
AWGPSSLHNGLGGSEEAVVFLSVELRKIGYWVEVYGDPPHQDLTRHDNAGTVNTYRGVAW
YPHYAYDPEDSSVDIFIAWRYHASLVTGQHARARYLWLHDIPSEVVLRSELLTSMIDGIF
CVSRFHASLLPASVQHKVIVTSNALDPEYFVHGDGTNRANNFVYSSAPSRGLDTLLRNWP
RIRTAIPNANLTIYYGFTTAFRNWGRANLPEFDTWMRELEQLIETLPSVHYVGLVGHREL
AAGYANAGFYLYPTTFSETSSVSLMKAMAYGAIPITSRFQLSALPETCNAFDLGPRPLQS
RTIDTLVLLAEDPEWIDLWIESIVDAVRNEDQTRAIRQQMKVFARSKYRWSRVAEHWRQI
FTGRSP
Download sequence
Identical sequences K3WA70
PYU1_T001861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]