SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002097 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002097
Domain Number 1 Region: 71-301
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000915
Family Rhodopsin-like 0.009
Further Details:      
 
Domain Number 2 Region: 800-918
Classification Level Classification E-value
Superfamily DNase I-like 0.0000331
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.01
Further Details:      
 
Weak hits

Sequence:  PYU1_T002097
Domain Number - Region: 348-551
Classification Level Classification E-value
Superfamily DNase I-like 0.0959
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002097
Sequence length 1241
Comment protein Name="PYU1_T002097" Note="Similar to DDB_G0271670: Uncharacterized protein DDB_G0271670 (Dictyostelium discoideum)" AED:0.0486930927472247 QI:0|1|0.66|1|1|1|6|0|1241
Sequence
MATPAPMSSTLSPRQETMKTIAAATSSGLSIIGALYILGRYWYTRRRMKTIANGEAAVTG
NAHHLDVTKELIHVLAWLDLIGAMGRIFGTLPTRTFDQSLGEPVTGICKLQAVVITFGDV
SPIAWNFVMALNLFRWICMGEDQLMLQQKIKWYVLGTLAFTFTIDFLALGFHKFGDAGLW
CWVVIPGEEHHKQELYWKLLTLYFWVIAGAIAMSTLLVLVKRDMMKRLQSHENEDAREAY
DGVVHNLTIYIVAFIVCWLPAVLDRGYFAIKSKEIFTLSIMHACIVPLQGFVNAVIYGKF
HIWIGRHANFKNIHSKSSSRTSNKHSEDSVHHREMLRDQERQHFGTATIFITTFDMNWNP
FPTNLEDWIPAGKDLYVFSLQHCIGVQTVQQSIQKHLLRMNYPTAYRSITSLAGSALRDQ
VQDATVCQIVFVNNADDASGNFQFHPNDGRVWSQRKTFKEVVGIPIRYFDASIAFVSCNL
SSGDHLQHTSRSVLEKHAIATSLIHSFGMDADRAAVDFPNLYHHTFLSGNLNYDVEMPRQ
GLLNTMEQAYKAECLKKATDAAIAAKLKTAQQPAQRQSTDRSTSSGGRERPSSPNFGYRE
PPNANVQVEWNLLYFKSRNSLGRSSNVSSSSDDAMGSEGDAMYQEIYTSCHDELPFTLLR
SPAGLAQNSSAISESLNASMLSNSSSLAPDLRNISVPETKDAINDASEVRINISGGVQGD
NESARARRSWMSFLDSLFPPQAPERTSSFNSFTTNPTRRSTMSSRNVANGGNTNGAANAR
NDGKKVNDLLSKSQLVTDNTMRKWKELLRFDELRAAIEAKEAFCGFEEPEIHFLPSFPRK
VGTSASFSMLSDRTCKDLFLESNLDISLQSFPPAYKDRVLSHSLQDTKQRLRNVGYWLCE
EITTSTHKPVCSLYELEIDRFFAYKMDEAARVDSRQGNRALRDKTGVQEFKIKLVNLDAN
IWSTVARDSGSQLSSDSSHTKKHRKVHATPASHPASPSESRDDTNDSNTSNGVSDSTQSQ
SRRSSSVRTLKKKRSGTNIVDRVLRKDRHRSSTVTSGSKASTPNPYSDFQSEAGGSHPLA
LAGDRLSSLTPFHLELVPVEPVSISTVFPLPSEDLYALQRKVYEVAHSVQSGFQSSANND
DLEESLLAYTNCRTVAWKEAGKQGVTHTAITKAVNGVVHIAVTIKAEKGHGGQGVLCIQE
QDLLERAKPVLSESEPIPFDVTLTWGGKHVGYLHGDILSSL
Download sequence
Identical sequences K3WAV6
PYU1_T002097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]