SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002261 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002261
Domain Number 1 Region: 253-298,352-433,461-677
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000273
Family Hermes transposase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002261
Sequence length 711
Comment protein Name="PYU1_T002261" Note="Protein of unknown function" AED:0.140449438202247 QI:0|-1|0|1|-1|1|1|0|711
Sequence
MSPTTSGAEDANALDPSGSNAAFPHGVESVDHDARAASVAAATAAGFGVSVLSLETHPLH
QFQQGAVVTASSSPPPSSVAVATAELVVQHQNAPPPKRKGGRAKDAIWNETTIMEDKTVV
CNHCSAVIHKYGCAKVERVRAHFQNRCLQSANYQNRNVHAAAVKKQKTAHSPSNGNSDAV
NRRGAESVGVAKVGLFKRKFTQWVYATGQAFDDMENEFLVNALCTLRPDVPLPSRDELEN
ELLELECNATQAKVNKALSGNACILAIEHWTNASGVVHTNYVALCDNTPYLLECTTSSQT
QDAAAEIPVEELEAVLAKHKKCAFYAIVTTEKAMLSNATCERIQKKYLQCVFYYGCVRHA
LRLLVNDITATLPWLEKTRDSVTELLRVVQGSYKLQLQVPGLPRIGADGNLGSLLSYEQV
FDALEAILSSEKELYAVVSRRDFVEASRSPVEKEQRKRIQDFVLGETFVNDVNNALKLVR
PLQQQLLRVESDRSATLSQVYHCFVELLDTYVSMEWVSKKDKALISSCVKERFHSIYGDA
HGVAYMLDPLYLGEHLDAAKKSEVEAFITLYCNGLEPEKILTQLEKYKAMVHELKECNST
YWKMLESGEVRTFDFWIERRQFPQLQQLAWAVFSLPNASTTPSKSFSAQCQLIHSKFQTK
LSAEKLQRLTQVNCNAKSVAATSADGAELSPLGAVADATTFASNNPPSAIL
Download sequence
Identical sequences K3WBC0
PYU1_T002261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]