SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002467 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002467
Domain Number 1 Region: 572-728
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.33e-26
Family DnaQ-like 3'-5' exonuclease 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002467
Sequence length 971
Comment protein Name="PYU1_T002467" Note="Similar to SDN5: Small RNA degrading nuclease 5 (Arabidopsis thaliana)" AED:0.0401234567901234 QI:0|0|0|1|1|1|2|0|971
Sequence
MASEEEWEDGEILEEGEEAQDVQAVAPEALEAATRTDDPMEEEEGAAPAPPSAPAAAPAN
EPILSSPPPEHMRRGGRPYDKPSVAQSQLYSVLPRPPNGGILGPAPPLPQSDERYPRKRL
HSAMQEQHNAAAYPAQNGPRPPYPQQQQQNYANGNAGPAGRRSHFEYETYSADLIVKYPR
QVVKSNVLLNFAHWMEHARSRLRLDVEDIQQLILRIVSTPAASDEADESNKTTSSNVSPF
LLDSLSPHKSLPTKVCVVLLGNVHPSVLQRYRSTLAFFDGCTSVPCVLSKSDQSKRFETP
LPELLYKFPRPPVDTKDMPAEELFYGHELTFLMQHSFGYMDEVVVLPSGSFMRKSQPLGG
TWELDGDLLHLKWRQQVKTSTSTVATDENVNDEEDEAFTLDVLVSEDATMHYFSTDPVID
KTYARDTPEHLGRKREGASERTIRFSLVKAISVDVPRTPEGKIIVPGNKEKVANGGEPQD
DNAVNGSESEATAGTLPEEKESAENGAELEGIEYYVLSEQELIQHGYPVAVDVEQKLLEA
ATNGCTRDQFVQTRPRDGNETPVENDRKPLMYALDCEMCETDLGYELTRVTVVDEHGKVV
YDQLVKPQSTIINYHTEFSGITPEMLQNEKCILADVQRELLTKYLFADTILVGHSLTSDL
RALRIVHLKIADSSILYPHQRGFPFRTSLKYLTKTFLRKDIQLHTTVTGHDSAEDAIAAM
ELVQLKVRHGPSFGIPETELTAAGAFDSFAHKVDEQGKRMAFLRLTCNGNDEGEQQEPQN
GSEALQPKPEGSNNIKQEKPWHLYASGELSAQARSPFVHAQKFVGKLSKVPVMSKVDECA
TWDTLKESVQGSLVSQEDAICWLEIAGPSDHSTASDFLFRHDEWMQKQRAHCEKVSAWLQ
DLQDTVLPQGTLLLTVPQGDLSMLRYLKGLRTRSKWRDAVPNSQWTDDMQAAVTDAFRGT
MDSCVFLTQKD
Download sequence
Identical sequences K3WBX6
PYU1_T002467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]