SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002768 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002768
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily Tautomerase/MIF 6.48e-16
Family MIF-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002768
Sequence length 80
Comment protein Name="PYU1_T002768" Note="Similar to MIF: Macrophage migration inhibitory factor (Gallus gallus)" AED:0.141975308641975 QI:0|0|0|0.5|1|1|2|0|80
Sequence
MAKLSLDQTTLFGGSDTASAYVQIRCIGQISKEHNTKSVQVLTTKVTELLGVPAERVFVI
FEDIPAMNWGVSAVTVDTLL
Download sequence
Identical sequences K3WCS7
PYU1_T002768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]