SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002878 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002878
Domain Number 1 Region: 12-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-63
Family Capz alpha-1 subunit 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002878
Sequence length 289
Comment protein Name="PYU1_T002878" Note="Similar to CAPZA2: F-actin-capping protein subunit alpha-2 (Gallus gallus)" AED:0.0474254742547425 QI:0|0.83|0.71|1|1|1|7|132|289
Sequence
MADEWGYEDAPDDEKLRIAQHFLLSSPPGQIHDVLRDVAKLVPARVLTDSALRGALRAYN
VANTLPIDVPDADYRMLICEEGEVDATHYVDPIGKRVFGVDHVKQQVIPEDVAELPASFT
TSFESERLLVEKALQSYLQFEYMHQGTAGVYVKDTHLVVNFCAQRINLRNFWSGRWKSRW
EVDLSVHPLVVKGGIALHVHYFENGNLQLQNEKVIDDQELRVESTTALGDALLRVIKDAE
DDLQTNLEDMYINMSQETFKEMRRVMPITQTKMEWNLHAHRTARGLGNK
Download sequence
Identical sequences K3WD37
PYU1_T002878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]