SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002911 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002911
Domain Number 1 Region: 426-526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000118
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 86-192
Classification Level Classification E-value
Superfamily EF-hand 0.000000000038
Family Calmodulin-like 0.013
Further Details:      
 
Weak hits

Sequence:  PYU1_T002911
Domain Number - Region: 236-326
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000558
Family Fibronectin type III 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002911
Sequence length 623
Comment protein Name="PYU1_T002911" Note="Similar to Stim: Stromal interaction molecule homolog (Drosophila melanogaster)" AED:0.0905353716578206 QI:0|0.33|0|0.5|1|1|4|0|623
Sequence
MRLTLRAAALLLALTLALTWQLSAAIDVLEVRSSTPAATPPGEDAAIEVEVHVDGSPSET
LEMLEEEERAAVRRRRKKPQVESLLADFDHDGHVGSSEIQRIKENLHQFFDIDESGSIDS
VEIKTMARDEKDVVSAFQKLDSDHDSIISLKELDERWEAVGAEMTVSEVADWVAFAVQLP
QYANIFRDHSISGYTFPLLMANDGKRLQEIGIDQHLHRQQLAMFLKMKYLGMGKKPSPVV
SAVCTTEPSATGSESGQAPSKTLLHVAWVPAEDVPQRFQLQRRSPGEAAWSLVYTGPDTE
FIDVVDTGLHVAYRLATWNSYGRSPHEYIRCGPVAGVASTKPAFVLPPAASTTSGSIVKA
DALPGHHALNFSSDGGESADTFFGVLKSYLWWLDEAIALTLFIVLPIRGFIYGDADYVLK
IMRRLPPNMPTRVTVEADPSKTSLEGATVTVSWEKPIDNGVPIVCYCVRWTRTKTEEMKW
VKLLTLPLPTSVPVSHLKHGETYKIVVEATNQFGLVTKSSRSTYMVPVPELKGKLLPRRS
MKEAKVLRNQCHICSDPVKKKKVPFTATLDRRILHFCCLCDQEFCHYHKGEVYHTKALSC
PAVDGRCICETCKDIRLQRSVTY
Download sequence
Identical sequences K3WD70
PYU1_T002911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]