SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002912 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002912
Domain Number 1 Region: 285-732
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-21
Family Hermes transposase-like 0.0065
Further Details:      
 
Weak hits

Sequence:  PYU1_T002912
Domain Number - Region: 60-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0179
Family BED zinc finger 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002912
Sequence length 769
Comment protein Name="PYU1_T002912" Note="Similar to ZBED4: Zinc finger BED domain-containing protein 4 (Homo sapiens)" AED:0.0507547760000927 QI:0|-1|0|1|-1|1|1|0|769
Sequence
MTTPTNGLGQMLPLSAHDVVSVNMGVVGPAGAGMGGGNGTGGNGDPSQSLKKKKPGRSPS
QIWTLLTDEPNPQRKNAAACKHCKQQVLYYKKSEQAIRHLKKCNVFQNSQHQYAFISQFQ
DILQMYNQKITTKMPSKKRQKTSAAAVAAVSSALDQAAVHHAQAMNQLAMQQGMPDSLMD
PTTIGLKDDTAKELKSTGKDRKGKGGGGGALSKSQLERMEEAIAMHAYVTGMAFDAVEEC
HLQRAIAILRPNVKLPDKKRLEGDLLRRCYDKMHKQVWNYLTASSTRVCIKRDAWSSMNL
YNTSNPEEVYVTYMAGNNEKRFFLESEKINDDGQYNSILIAQDIKRVMAPIVGSVSGVVT
GSTEYHARAWEMLKAEYPTKFFYGCISHALHLAIMDIFGPEKSIENDPRRMTPQVPMDFP
FQDLVDFTNNCNELLSFFSSYQYAPKFKMFDAQTLQTMKSFSTSSPTMQWGSLAARFRVL
LQAEDIIQSIVSDPDFVDAAPLNQRPTRDSLKSFVLNLNWKIALEKAISILTPIELTLYK
FQDDKPISEVYFESKHLLTDFDAVFGLSTVELEYIKKVVTERWQYVLSEAHGLAFLLDPR
YIGKSMTREYREQIEELIFNFPETDADIGVNEERKRAISAEYTDYVIYAKNQRANRTFKW
EMLEKGNRSPLQFWMTEADDWPHLKSLALTLFSLAPSSVASEKTLCKSTLLQSSRRNKLS
FDDMRCLAFISINDTQFTGNRVGDFQNALPDFNMNDPGLSPEGMMMWMI
Download sequence
Identical sequences K3WD71
PYU1_T002912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]