SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002966 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002966
Domain Number 1 Region: 111-210,301-439
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-34
Family Adenain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002966
Sequence length 464
Comment protein Name="PYU1_T002966" Note="Similar to SENP7: Sentrin-specific protease 7 (Homo sapiens)" AED:0.0569932475678443 QI:0|0.33|0|1|1|1|4|0|464
Sequence
MPLTTVSKGSPQTAESASTAIKKDSMEFFRQPASHSNAVVEIDDPSQPSWSGGTDDAREN
QATTNNDDDTSSCNAANGNCESANATESQVKAKTATLLTYPYGESGEQKNAGKISITYGD
IARLAPGEFLNDSIIDFYLRFLWRHLESWQKECVYIYSSHFFTQLSGSGALTPDERFARV
SRWTLKESDLFEKRFLFIPINDSVAVFCNPGSAIIQKRRRLQQVVMLQNGDVSTCRRIAL
ENGEPIIVDLVDNFNYFRRENGQDQGETVRPPPQQNESVEVKEEYVEEELELTQQNRQQH
PPCLLFLDSLRCHRKKKFTAMLREYLDCEWKSRLSGHESVEQKTAESIVPSGIDDESIVT
YFDADSITLLEPEIPLQTNSSDCGVFLLMYAAEVLRRFPAGITREDVETNFSATLTSEMF
DGEHVLEFRDYLHQLIFCLQSLQKRGLSENHVQDEELDTFTIDR
Download sequence
Identical sequences K3WDC5
PYU1_T002966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]